SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F4G1P2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4G1P2
Domain Number 1 Region: 132-210
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.31e-19
Family Translational machinery components 0.0025
Further Details:      
 
Domain Number 2 Region: 48-119
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 5.02e-18
Family Ribosomal S5 protein, N-terminal domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F4G1P2
Sequence length 214
Comment (tr|F4G1P2|F4G1P2_METCR) 30S ribosomal protein S5 {ECO:0000256|HAMAP-Rule:MF_01307} KW=Complete proteome OX=1006006 OS=Metallosphaera cuprina (strain Ar-4). GN=Mcup_1947 OC=Metallosphaera.
Sequence
MAEEVPVSNVEEWKPRTKVGQLVKEGKISSISELYARNLSIVEPEIVDVLLPNMKYEVID
IGMVQKQTDAGELSRYKVLVVMGNYDGYVSIGVGKSKQLRVAIQKAIRDAKMHVIPVRRG
CGSWECTCGESHSLPFLVSGKAGSTEVVLRPAPKGTGLVAGGVLKSLLTYAGIKDVWSFS
RGETRTTDNFIFAGYKALYNTYRFVTPLDWARRR
Download sequence
Identical sequences F4G1P2
gi|330835805|ref|YP_004410533.1| WP_013738547.1.2613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]