SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F4IMK2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4IMK2
Domain Number 1 Region: 5-261
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.26e-33
Family Hydroxynitrile lyase-like 0.0000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F4IMK2
Sequence length 265
Comment (sp|F4IMK2|MES6_ARATH) Alpha/beta fold hydrolase/esterase 1 KW=Complete proteome; Reference proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=F26B6.20; OC=Arabidopsis.
Sequence
MENKNQKRFVLIHGVCHGAWTWDKVKTQLEVAGHCVTAVDLAASGINMTKVEEIQTLNDY
CKPLLEFLSSLGSDDGKVIVVAHSMGGISAALAADSFACKIAAIVFLTAFMPDTINPPAY
VYEKLLRSIPQEEWLDTTCVNYGKPDFPLQYTLLGPKFMAKKMYQNSPVQDLEVVKTLVR
ENPLVTNNLAGTRSFSEEGYGSVTRIYIVCREDLVEVEDYQRWMISNFPPKEVMEIKCAD
HMPMFSKPQEVCALLLEIANKYCKN
Download sequence
Identical sequences F4IMK2
AT2G23550.1 3702.AT2G23550.1-P AT2G23550.1 NP_001318274.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]