SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F4IUU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4IUU9
Domain Number 1 Region: 19-201
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.05e-19
Family N-acetyl transferase, NAT 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F4IUU9
Sequence length 235
Comment (tr|F4IUU9|F4IUU9_ARATH) Acyl-CoA N-acyltransferases (NAT) superfamily protein {ECO:0000313|EMBL:AEC09623.1} KW=Complete proteome; Reference proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=T7F6.17 OC=Arabidopsis.
Sequence
MGACNASQIVDLFPAVSPEIVVREARLEDCWEVAETHCSSFFPGYSFPLDVVLRVDRLMA
MVMGFSIPPGCQRTCLVAVIGSSVDETICFGSDDFKIGAFDAKISLNKGYVAGILTVDTV
ADYLPRKGPLRQRRTGIAYVSNVAVRENFRRKGIAKRLIWKAEALAKNWGCRAIGLHCDL
NNLGATKLYKDQGFRSIKIPEGATWPQPKTSPDTRFTFMMKLVNNNNTQALEQFR
Download sequence
Identical sequences F4IUU9
AT2G39000.3 NP_973638.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]