SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F4MSR4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4MSR4
Domain Number 1 Region: 7-98,145-247
Classification Level Classification E-value
Superfamily PHP domain-like 0.00000000000000981
Family PHP domain 0.0031
Further Details:      
 
Domain Number 2 Region: 272-406,728-813
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000598
Family ABC transporter ATPase domain-like 0.055
Further Details:      
 
Weak hits

Sequence:  F4MSR4
Domain Number - Region: 506-656,732-807
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00035
Family ABC transporter ATPase domain-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F4MSR4
Sequence length 862
Comment (tr|F4MSR4|F4MSR4_STASA) Uncharacterized protein {ECO:0000313|EMBL:CBW54948.1} OX=881952 OS=Staphylococcus saprophyticus subsp. saprophyticus MS1146. GN=SSAP_P133 OC=Staphylococcus.
Sequence
MFQFGTEWIRADFHLHTNADKEFIYKGDQDRFVSDYIKKLKEENIKLGVITNHNKFHLNE
FKGLKKKARTENITLLPGVELSVKEGANGIHCLIVFKEEDWIKGNSESINQFLDEVFKGI
ENRENENTRCNKDLAGTVEALNSYNKDYVILMAHIEQKSGFLKECNGGLIESLSKNSWFK
DKVIAFQKGQTRDKMHQLERWMGYRLPYIEGSDCKSIEEIGKGKKSYIKIGDGSFDSVIL
ALRDYQNRISQLENNHSHGHIKSVEMIGGKMNNQKIYLSPELNSLIGIRGSGKSSIIEAI
RYCLDMMPSITDENYKTEVVKNLLESGGQVIVEIQDNHKKNYKVKRILGESSHVLDEDGE
EIGVTVNSILQTPLYFGQKDLSYMENGFELDLLSKLVGKKIKFFERDLTNINDQLGNHVN
QLFQLNDKLETLPDLNRSLTDIEHKIRIFEENGLNTKLSKQVNFQKDERSIENTYDRINE
FKKDLKLLLNSPNLRELDELCKQESLEVPELFSNLSKEVTSVIAVKKEIQEIIGKVDSSS
EQVKKYLEEIQAIIGSLEEEFAEIKRDIDIPNLNPDDFAKLKTNEDKIRKDIHQVNTQEE
TKDQIESKIRADLEERNQLLLQEFRVYNDEIEKINSNQGSLELSIEFKGNKESFLENLKQ
SFKGSNINQSTYRAISENHSDFSALIVDILLDDSKVTSSLVTEAQLSRVKEIIKANYNEQ
LKIRTPNKIEIQYHGKPITKHSIGQRASALVLFILSQKDNNLIMIDQPEDDLDNQIIYNE
IITKVKERKPEVQFIFATHNANIPVLGDSEQVIAVSYNEKQLSAKTGSVDNKDIQQKIVD
IMEGGQEAFNKRTQIYNSWKNV
Download sequence
Identical sequences F4MSR4
gi|330827456|ref|YP_004400656.1|NC_015432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]