SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F4P4I4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F4P4I4
Domain Number - Region: 48-80
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000471
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F4P4I4
Sequence length 107
Comment (tr|F4P4I4|F4P4I4_BATDJ) Uncharacterized protein {ECO:0000313|EMBL:EGF80033.1} KW=Complete proteome; Reference proteome OX=684364 OS=chytrid fungus). GN=BATDEDRAFT_25648 OC=Rhizophydiales incertae sedis; Batrachochytrium.
Sequence
MATASPNLELTNQVVAHATSKKIVLNKEMQTQLDQDKIQLRIENELYIRQHPEIRNIIGY
FIQKVLVHRPVNLPEFAVALLANPELKQEVEQFQQETQRPEIKIQYK
Download sequence
Identical sequences A0A177WH75 F4P4I4
jgi|Batde5|25648|fgenesh1_pg.C_scaffold_7000400 XP_006679496.1.45406 BDET_02991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]