SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F4RW71 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4RW71
Domain Number 1 Region: 74-604
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 8.44e-108
Family Fungal lipases 0.00000329
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F4RW71
Sequence length 612
Comment (tr|F4RW71|F4RW71_MELLP) Carboxylic ester hydrolase {ECO:0000256|RuleBase:RU361235} KW=Complete proteome; Reference proteome OX=747676 OS=leaf rust fungus). GN=MELLADRAFT_109356 OC=Pucciniomycetes; Pucciniales; Melampsoraceae; Melampsora.
Sequence
MVGPLHLIFSLAGLQYASTAILPQSDVKSFSRRSGLLGLGDLPVLGPLVDQVTQNSLPID
KPKMPEVPSGTGSIKVVLDYGDFNGNTNKSVDQFYGIPYAEPPVGSRRLTNPIFPLGKYP
NFDATRTPPSCPQQLATGGGNPIFDIATVLTDELDRLPIYAPTLGGQEDCLTLDVLRPTG
IKEGTKLPVMLWIYPGDFALGSSTLLQGNTWVEKSITLGQPVIWVSMNHRMGAFGFLGGK
EVGAAGIGNLGLKDQRLAMKWVQKYITPFGGDPTKVMLFGESSGAISTSHHLFINNGNNE
GLFRAAICESGSAFPVGTLAEGAGQTTYDAILKDTGCDNKPDTLGCLRTVDYATLFAASN
RLPGFLSGGSFPLAYAPYVDGEFVTGSMEDNLAAGKFARVPLITGAQDDEGTLLTLGVTS
TIITEENLKPYLARLVPKATQEQINILISGYPEDPTQGSPFNTGVLNAITPVFKQYAAMF
GDVGFQGLRRLVSRQVNRQMPTWGYIDRGMKSLPILGSTHAIELLSTFNIIPGPRADDFQ
ARWISFANTLDPNVQGLPKWEKYGGESGTDDFKGNILQFESSGSTGTISDDFRSTQINYY
LDNLKSFRLLSA
Download sequence
Identical sequences F4RW71
XP_007413506.1.63152 jgi|Mellp1|109356|fgenesh2_pg.36_#_21

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]