SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F4W506 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4W506
Domain Number 1 Region: 30-138
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000011
Family Spermadhesin, CUB domain 0.0072
Further Details:      
 
Domain Number 2 Region: 216-250
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000235
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  F4W506
Domain Number - Region: 166-205
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000607
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F4W506
Sequence length 350
Comment (tr|F4W506|F4W506_ACREC) Cadherin EGF LAG seven-pass G-type receptor 3 {ECO:0000313|EMBL:EGI70702.1} KW=Complete proteome; Reference proteome OX=103372 OS=octospinosus echinatior). GN=G5I_00494 OC=Vespoidea; Formicidae; Myrmicinae; Acromyrmex.
Sequence
RMKMKTTMSSVFLLCLFCFNLPDVIMNFDPFCGGHLAGPRGVIHTPNFPGSFPIPIKCRW
VIDVSDIPSTNSSIVVYLTQLYVYKGLRFTEYAYYESETMNFGAALIKEVTEGNVFEYQR
LRTFRPFLVVEFELDRLEGNHVRVLNDLLDVYGFNVTYEMTEEHPNLESCTIRDCSFAGN
CLVSADYTSFWCDCFDGFNGRSCNEGPLCFNDENIPVCQNEATCRQTGAEAMHCDCPDGY
VGHNCETRLLDTSDTECALENCILQCPVNEQEQPCTCKDGTKIYNNRSRYECRIKLSNVT
SLRTGLISQHGSMESFVSKQVSEGESEICCIRFVIVFYCFFLLRKNIRTI
Download sequence
Identical sequences F4W506
Aech_06732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]