SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F4W7A4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4W7A4
Domain Number 1 Region: 70-162
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-20
Family Cadherin 0.001
Further Details:      
 
Domain Number 2 Region: 13-80
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000385
Family Cadherin 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F4W7A4
Sequence length 202
Comment (tr|F4W7A4|F4W7A4_ACREC) Neural-cadherin {ECO:0000313|EMBL:EGI69777.1} KW=Complete proteome; Reference proteome OX=103372 OS=octospinosus echinatior). GN=G5I_01318 OC=Vespoidea; Formicidae; Myrmicinae; Acromyrmex.
Sequence
MPGSTAQTNKFHTFYLQQRGEQSTTWADIKVNHPLDYESIKEYNLTIRVENNGAQQLASE
ATVYIMLEDVNDEIPLFTEREQETVLEGEPVGSKVTQVNAIDKDGTFPNNQVTYYVVNSE
RNEGKDYFEINRETGEIFTKVMFDREKQGAYALEVEARDGAPSARPNGNGQPNSGRWYGK
FYLKAVCARRTDCIARTINSVK
Download sequence
Identical sequences F4W7A4
Aech_02794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]