SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F4WJL8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F4WJL8
Domain Number - Region: 112-135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0167
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 16-68
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 0.0301
Family Obg GTP-binding protein N-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F4WJL8
Sequence length 182
Comment (tr|F4WJL8|F4WJL8_ACREC) Uncharacterized protein {ECO:0000313|EMBL:EGI65634.1} KW=Complete proteome; Reference proteome OX=103372 OS=octospinosus echinatior). GN=G5I_05899 OC=Vespoidea; Formicidae; Myrmicinae; Acromyrmex.
Sequence
MAEIVQMFLFLYKSKYRRKRRRDVDDDDGGGGGGGAWFDHNREENCDQRWRCRCRCRCGH
GSGSGSGNATATMPWVPFLLWAALVCWVVHVSAAASTSSSSPTLDAGCDPDTCVNGVCEN
GICVCREGWQGAHCQFCGGKVSCYKEKADEGIVQLKSRYLVLSADVETSKKLKIKPRLNL
HT
Download sequence
Identical sequences F4WJL8
Aech_12098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]