SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F4WJM8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4WJM8
Domain Number 1 Region: 1062-1103
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000484
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 2 Region: 992-1030
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000314
Family LDL receptor-like module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F4WJM8
Sequence length 1152
Comment (tr|F4WJM8|F4WJM8_ACREC) G-protein coupled receptor {ECO:0000313|EMBL:EGI65520.1} KW=Complete proteome; Reference proteome OX=103372 OS=octospinosus echinatior). GN=G5I_05909 OC=Vespoidea; Formicidae; Myrmicinae; Acromyrmex.
Sequence
MNMQPVTTESADRLAIKPAVTIGNPILEAFPEETQRRRFPNSMLQKPSAYLIQITSKSKD
NNSSSQYVKFGRFHNLDTNCSNAEVYHPTVNQTLKRSSNESRIPKPFKLSDSLVRSLQLF
QQKNISLKNFGLQSINNRDKTRKMISGSNPDCAPKQSNTFNVDATIMILGPSKKGKYVTE
KNISKSNNSNIRTVIEISSKIDMEYQNSDKIKRTPTKLENNTSKNNIDNIKAIHRSKNIT
VEAAKNIDEEIDTENPLMIKKKSTDTVTQRIDNLICKFIKAKHMVCRQSDSTEVSIKPIY
TTSKITTVTNDANINRNFNMTDVRGNSKILRKNQRRKHGSAYQKYYDKYLRNLITSSTMK
VSTEFAVDTRTSTTLKNTFLKNINKHEVTKAWQTEKRDMLENVTGFIYSDVFNNTHGQSN
LPENYIETKNNNPNNKEIFFGYEVRKDSKVSNYYNKYLKHRVTPFKRTAPVTVSTKIEEY
NMTNMKYDQQKAASSVLGEIFATTKSNKNDYSSIKTEKLLYELKSPKAEIHRRYFPTINV
DNIDMISNLSISNHNATQQNRSNEKYNKTHKQSDISFEKCCDENLIQSNEKIDSGLINSG
ETPESIPIENTNTISKESHESREILEEKSEDDFDVVLFNFTTTRVPEIVTRDANEPREDP
EKTSTERHGKRKHKSRHNSRKNNRPKKRRKNHVKRKRKPTSSVASKVDEPTSVDYDSAYS
SERVKMLSPNDLEYNEADNRNTSTGGNDWYLTAEITTEPFKIESSNADESVSKHPTEDSI
DDEFQSEETNADLVTSSTISYLSTASNEKISKKCKILITTESNWLNWWTNDNKKTDEEST
ECEEDVTSLPTTSDSIEEETNYYSISVSDHFSIYNTISILDSTTLIWEYFSKENKNVSDE
EISTTFSMIKDEENNEKKVMVSESILNEESDKNNEGTQSWESITNFGGTTHNVNLDFNSE
EEEDGLEKSISDEDNEIDNGIAETIEDYEIDNCNETQHACDKYTCIDEDQVCDGIVNCLN
ANDETDCDYIYSKRWEEHQRINDKRIDFTSNTVDDTSHLDGCSPFEHPCDSMCINALHVC
DGKRDCLDGTDEENCTKGIPHVENNTLRETSHFTLCSRCKNYLALDGASRESQASVTSFR
DDLSSSLYRTWL
Download sequence
Identical sequences F4WJM8
Aech_06211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]