SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F4WKN7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4WKN7
Domain Number 1 Region: 154-457
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.22e-38
Family NodB-like polysaccharide deacetylase 0.02
Further Details:      
 
Domain Number 2 Region: 47-94
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000497
Family Tachycitin 0.028
Further Details:      
 
Domain Number 3 Region: 109-144
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000072
Family LDL receptor-like module 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F4WKN7
Sequence length 518
Comment (tr|F4WKN7|F4WKN7_ACREC) Low-density lipoprotein receptor-related protein {ECO:0000313|EMBL:EGI65129.1} KW=Complete proteome; Reference proteome OX=103372 OS=octospinosus echinatior). GN=G5I_06307 OC=Vespoidea; Formicidae; Myrmicinae; Acromyrmex.
Sequence
MWLGLRFVLITLLAVSANIMAEKGKSGEVPCIDDNKFYRNPKAPSHSIWSPTECAKYFLC
LDNEVFEFKCSQGLLFDVSRQICDFKTNVNNCDITSDAQPAKPLLKNGECDEESLACGDG
TCLPALYFCDGSVDCLDGSDEGWCDMRHDINAAPICDIEKCQLPNCWCSEEGTRIPGNLT
AHAIPQMITITFNDAVNAENFELYSKIFTDDRKNPNGCPIKGTFYISHQYTNYRDVQYLW
NTGHEIAAHSVTHRGPEEWWSKNATIEDWFDEMVGIANIIKKYAAVRIGEIRGVRAPFLQ
VGWNRQFLMMSEFGYVYDSSIVAPFSDPPFWPYTLDYRPPHPCVRAGQLCPTRSYPNIWE
LPLNQFLTNDYMCSTVDSCPSDLSGEDIYKILMLNFKRHYLTNRAPFGLHFHASWFQNPM
YFYAFNKFIDDLLRLEDVFFVTNHQIVEWMRKPTPLNEIEKFTPWQCTKRHFEPYEMACD
LPNSCKLLSKVLKSYRYLHTCFECPKQYPWLRNEFGIE
Download sequence
Identical sequences F4WKN7
XP_011054777.1.86870 Aech_05144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]