SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F4WPF7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4WPF7
Domain Number 1 Region: 1263-1401
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000439
Family Growth factor receptor domain 0.0093
Further Details:      
 
Domain Number 2 Region: 1162-1306
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000267
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 3 Region: 882-1061
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000004
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 4 Region: 245-376
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000251
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 5 Region: 682-801
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000267
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 6 Region: 152-184
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000107
Family EGF-type module 0.015
Further Details:      
 
Domain Number 7 Region: 551-597
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000474
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 8 Region: 1126-1170
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000509
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 9 Region: 787-851
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000322
Family EGF-type module 0.025
Further Details:      
 
Weak hits

Sequence:  F4WPF7
Domain Number - Region: 188-226
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000104
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 607-637
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000948
Family EGF-type module 0.01
Further Details:      
 
Domain Number - Region: 365-422
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000973
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 1050-1077
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00545
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F4WPF7
Sequence length 1527
Comment (tr|F4WPF7|F4WPF7_ACREC) Fibrillin-3 {ECO:0000313|EMBL:EGI64052.1} KW=Complete proteome; Reference proteome OX=103372 OS=octospinosus echinatior). GN=G5I_07634 OC=Vespoidea; Formicidae; Myrmicinae; Acromyrmex.
Sequence
MEAQFEKCCGLGSSWAQEGLRCEKFTGPVTGVPRVEQGLCLEAVDICCVRAYHELQCEKG
KADARKGLACVTSTTSQRSPKTFGRGDYHRDCCEGCKLGILAGSMGQGCSFKSFSFGIPW
DPAFLECCREASPSSTTDLTKLDDICQLMKGMLCTDICVPTPGSYRCECRDGFTLLEDGK
TCRQDQPIDRCKPTHPCEHRCTDNGVAVVCSCNPGYDLAKDARSCTPKSPRKKMLDEDED
DESPLCPSGYRYNATNQVCDDVDECLERNVCPGGGCQNTIGSYICIREKSAKNALYKACP
PGYEWHPLTNDCADIDECTILSAACTTDKPFCVNTPGSYTCLEMTGVKSCPAGFKFDKSL
QLCKDVDECAEDIHSCVTDVEQCRNTEGAYECDIKCGKGFTYNIGLGVCVDIDECIESSN
SCPNSDTICVNTEGAYECTKTSASPFLHILNDNNPSDHQKNMQSSSRTCSAGYKSSNDSG
ITKCIDVDECNEVGSYRCLRVENNKGTSTTEETNDNERDDRFSRGYKLEGTNISVMNEIE
DCGDGYFFDEKSDRCIDVDECANGIAICGINERCVNTEGDYRCSPICPPGFRLRNNSRPT
NEVKEHCEDINECLLGLHACNSLTQYCINTNGSYVCGTRTTTTRIETTTSSTTTRRPFAG
SRYNKVQVPRSSFSADRYWSTELCRLGYKRDASTGYCVDINECLAGPGCRDHEKCMNTPG
GYDCSPLCSTGWYFSTTTKSCQDVDECLLGGHDCPQSTHRCVNTNGSFICELIPPCSHGY
RRAFNGTCLDINECSENLHNCRLNLHQYCVNKEGGFECLTRLPSCPSGYEYSLSARRCED
IDECLIGQYNCDARFSERCVNLPGTYRCERLPPPRQRQRPACPSGYRYHPSLRRCTDIDE
CAEKLDTCGDKLCYNQPGGYSCSMPPVPMTRKPTTTPMPAPMNEKCIRGTRFVRNRGCVD
VNECRELEDACSSNEKCVNTMGSYKCTCKTGFRRDNLTQACVDINECQLQENDCLPTQRC
DNTIGSYTCTRFLPCGTGYTLNAATEICEDDDECVLGTHDCGSGYQCRNTLGSYRCDRTS
RIPTSQSRTSPMTTARITTITTTTPTSLTPITVSLATCPVGFELGSGGKCMDIDECQRTP
NLCATKMCINTLGSYRCGSRLICGPGFTLDPVTGQYCVDVDECREGTHECGKGQICENRR
GGYHCICPPGHALGPNNDCVDIDECSYAIGICGPNSRCENTVGSYKCLCGEGFENVGEAS
GTCQDIDECQRTSGLCQHMCFNVWGGYRCGCQAGFRLNADNRSCSDIDECTEFKDNHLCI
GICENTPGSYACKCPEGYRLGNDGRTCQDIDECEAGQVCRDAEEMCQNTRGSFRCNRINC
PSGYHRDPMRKNRCVRSSRFCRMDDLACLRSPSHYSYNFITFVSMLPMPSTGQLELFTMR
GSYQSESTVHFTMALVDVRAPPGVERVTESCFALKRPAPSQAVLVLTRTIPGPQEIELDL
TMEIYQEATFLGSAIAKIFIFVSQYEF
Download sequence
Identical sequences F4WPF7
Aech_01580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]