SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F4WW20 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4WW20
Domain Number 1 Region: 243-465
Classification Level Classification E-value
Superfamily GFP-like 4.39e-56
Family Domain G2 of nidogen-1 0.000079
Further Details:      
 
Domain Number 2 Region: 1020-1248
Classification Level Classification E-value
Superfamily YWTD domain 3.27e-38
Family YWTD domain 0.0000085
Further Details:      
 
Domain Number 3 Region: 203-240,470-558
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000173
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 4 Region: 557-670,697-717
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000136
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 5 Region: 733-865
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000188
Family Growth factor receptor domain 0.0094
Further Details:      
 
Domain Number 6 Region: 849-981
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000612
Family Growth factor receptor domain 0.0047
Further Details:      
 
Weak hits

Sequence:  F4WW20
Domain Number - Region: 1256-1292
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00632
Family EGF-type module 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F4WW20
Sequence length 1297
Comment (tr|F4WW20|F4WW20_ACREC) Nidogen-1 {ECO:0000313|EMBL:EGI61609.1} KW=Complete proteome; Reference proteome OX=103372 OS=octospinosus echinatior). GN=G5I_10174 OC=Vespoidea; Formicidae; Myrmicinae; Acromyrmex.
Sequence
MQRFFNIAFPLDDPVISPLYTHVDTRASGTIYWSETDSPDILARAGGLIRSAFKDANNFV
PTHVFLVTWMDVGYYNERNDKAKNMNNVHRIVFQVNTYQVAISSNGTHSFVELLYPENGI
QWIQGESHPNGLPDAKAQAGFMSEGKMYTLRGSGTDQIQNVDKWSNVNRPGQWLFQVGPI
DEGENVKTPDNIEDTMTMQQAASCRTGATTCHSKATCIDYEIGFCCSCKQGYFGNGKSCQ
PNDVPLRVIGRISGTLNGVEFPSRDLQCYVQTKDGRTYTALSRVPEEIGASFQLLGNLGG
IIAWLFAKPVSDTENGYELTGSGLFNHTAELNFPLSGDKVTIRSNYLGLDVFGQLKMEAK
ITGSVPHLERDTKIDYGDYDELYTRAQPGVIRSQSERTCKLLSGGGDEREINFKLDQIIS
YQECPYAIFDPEDDTTRLKFFRGVTAYENTEGIIRFAVNTKIAPLEEEDPCIQGRQTCGD
HSSCVVDGDSFRCVCNAGYQYLYEEDGSAICVDVNECTAGNHMCSPDAQCINQEGSHMCQ
CRAGFTGDGRVCERLPSCEDTRCGNYEQCAMIGNVPTCTCMPGFEETEQGCSPSQHAPCN
EEDNCSSYGLCISDGNKKKHVCVCMPGYVGDGYTCYSESDVTTTDEPPQPQCVVGVCWCP
SGWEFRNRACVRQEGEYTTIDYRDLSAHPLPGCFDDVCICPLGYDYDHLERICVPLPGYR
HDTMGPSGSKLSCNVVNRCHPYAQCIYVTSTGDYECRCNPGYEGDGMECTKTEVSCLEVD
ICDLNASCQYEEPMARCVCNPGYIGEGTTCSRIDECNDNSECEKNEQCTYHPMNSRYECT
CKPGFSMDMDDQCVQSDCSTNLSQCHVNAQCVPSSDSGYKCVCISGYHGDGMRQCVEDHI
GCNVLNNCGRNAVCAYNQTTTNFACICQPGYYGNGFTCRPQSSCRDDPNICSSEAKCVSN
GENQISCVCNDGYIGDGINCKRRPKHDSNFLLVNQGMATHRIPFMPTRQNPGNPIYIAYT
QMAIALDIDCLGGKAYSSDITGNRIVELSYNGSIAETFIPKVSSPEGLSVDWVSRNIFWT
DSGKTTVEVASLVTKKRKVLVSDGLVNPRGIAVHPYRGKIFWSDWNRASPKLEWANEDGT
DRAIFLQGDYVKLPNSLTIDWATDELCWADAGTFTISCIEIDSKRVTVVANELTYPFGLA
ISQNHYYWTDWKTHKIEVGMKTNGERRTPLSIPPGGSGKLYGIVVVPESCPRVTNVCQYD
NGRCNKNQLCLPDGQGGRTCACADDATGSCTDSRYLS
Download sequence
Identical sequences F4WW20
Aech_04556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]