SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F4WW81 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F4WW81
Domain Number - Region: 18-65
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 0.0157
Family Obg GTP-binding protein N-terminal domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F4WW81
Sequence length 133
Comment (tr|F4WW81|F4WW81_ACREC) Uncharacterized protein {ECO:0000313|EMBL:EGI61552.1} KW=Complete proteome; Reference proteome OX=103372 OS=octospinosus echinatior). GN=G5I_10115 OC=Vespoidea; Formicidae; Myrmicinae; Acromyrmex.
Sequence
MQRWAKDEAAVQKAREGGGGGQEGRLGLERGGPGGEGGGEGGREAKTLRRSIPSLRATRF
RSPAAFMHQERGQRDGATDRKSEKDGEKEKEKESRDNCGLRVRERVPFAGSAVPQDPKSI
MWLYGTSVRDAAQ
Download sequence
Identical sequences F4WW81
Aech_04486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]