SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F4WX61 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4WX61
Domain Number 1 Region: 30-68
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000000183
Family LDL receptor-like module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F4WX61
Sequence length 96
Comment (tr|F4WX61|F4WX61_ACREC) Prolow-density lipoprotein receptor-related protein 1 {ECO:0000313|EMBL:EGI61304.1} KW=Complete proteome; Reference proteome OX=103372 OS=octospinosus echinatior). GN=G5I_10552 OC=Vespoidea; Formicidae; Myrmicinae; Acromyrmex.
Sequence
MGRESRGVLLLVALAVLAAADAFSTDSKVACPLRQFRCANGRCIPISWVCDKSDDCTDNS
DESPEECKSKSRAELYEIRQINIHNSDDARDLYRRA
Download sequence
Identical sequences F4WX61
Aech_05132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]