SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F4WYC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4WYC8
Domain Number 1 Region: 18-53
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000798
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 2 Region: 63-97
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000288
Family LDL receptor-like module 0.0016
Further Details:      
 
Weak hits

Sequence:  F4WYC8
Domain Number - Region: 1-17
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00445
Family LDL receptor-like module 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F4WYC8
Sequence length 101
Comment (tr|F4WYC8|F4WYC8_ACREC) Vitellogenin receptor {ECO:0000313|EMBL:EGI60780.1} KW=Complete proteome; Reference proteome OX=103372 OS=octospinosus echinatior). GN=G5I_10977 OC=Vespoidea; Formicidae; Myrmicinae; Acromyrmex.
Sequence
CDGKSDCPKNDDEHNCVFCFDNEFTCDNKECILENWVCDKFNDCGDNSDEKNCDGSKKII
MESTKCDEFKCSIGTCLPYSKVCDGNRDCPDGSDENGKCRM
Download sequence
Identical sequences F4WYC8
Aech_17445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]