SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F4WYC9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4WYC9
Domain Number 1 Region: 22-59
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000055
Family LDL receptor-like module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F4WYC9
Sequence length 64
Comment (tr|F4WYC9|F4WYC9_ACREC) Low-density lipoprotein receptor-related protein 1B {ECO:0000313|EMBL:EGI60781.1} KW=Complete proteome; Reference proteome OX=103372 OS=octospinosus echinatior). GN=G5I_10978 OC=Vespoidea; Formicidae; Myrmicinae; Acromyrmex.
Sequence
MFVFKFDCEDGSDERFEACKSSCSNDKFQCNNGNCISLLLKCNGIDDCLDGSDERHCLVK
SIYL
Download sequence
Identical sequences F4WYC9
Aech_17446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]