SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F4X157 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4X157
Domain Number 1 Region: 270-307
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000123
Family EGF-type module 0.021
Further Details:      
 
Domain Number 2 Region: 239-270
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000645
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  F4X157
Domain Number - Region: 207-237
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00159
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 303-340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00837
Family EGF-type module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F4X157
Sequence length 345
Comment (tr|F4X157|F4X157_ACREC) Protein shifted {ECO:0000313|EMBL:EGI59824.1} KW=Complete proteome; Reference proteome OX=103372 OS=octospinosus echinatior). GN=G5I_12013 OC=Vespoidea; Formicidae; Myrmicinae; Acromyrmex.
Sequence
MRSAAAVLAAAATLALALLLDVADVALARHQHRSGNSGHKPSGDISLWIDQQQIKMFSGL
AMEIYAIAEGRVLAYLLDPEFENKLPIIPSEVSHVNFTWKSGVKKYYYNFFRLKSYDESI
LKTPSITIKKEGRVPKRPKDFSILLPCAGNSGIAQFGISLMIETLKGKPLNGTPLRLSLR
KECTVREPNPGPCPDGYLGPNCKTALCYPNCMNGGNCTAPGVCSCPPGYQGPYCEGGICT
EKCLNGGKCIQKDICECPKGYFGLRCEFSKCVIPCLNGGKCKGTNICRCSNEYKGNHCEI
ATTHITSQRSTCSKPCKHGTCQSNDTCLCEAGWYGKFCHKSKPWA
Download sequence
Identical sequences F4X157
XP_011063567.1.86870 Aech_14107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]