SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F4X5Z5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4X5Z5
Domain Number 1 Region: 222-427
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.33e-47
Family Reprolysin-like 0.00016
Further Details:      
 
Domain Number 2 Region: 442-519
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 8.24e-21
Family Blood coagulation inhibitor (disintegrin) 0.00033
Further Details:      
 
Weak hits

Sequence:  F4X5Z5
Domain Number - Region: 672-711
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00452
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F4X5Z5
Sequence length 1264
Comment (tr|F4X5Z5|F4X5Z5_ACREC) Disintegrin and metalloproteinase domain-containing protein 11 {ECO:0000313|EMBL:EGI58128.1} KW=Complete proteome; Reference proteome OX=103372 OS=octospinosus echinatior). GN=G5I_13790 OC=Vespoidea; Formicidae; Myrmicinae; Acromyrmex.
Sequence
GEVERLLHEYRQNQELIRNIGGHYYQIIYPVQLRHHEKMGISTREVGVPKFPQRGYGDGG
YQNPRGRLRTGRHFHRTSLLIKAFNHKFRLDLELNTQLLAPNLIQKDFLAGNAEQMSKQE
IEHCYYHGTVRDYPGASAAFHTCNGVSGVIHLGNETFVIHPFYGGDLSKHPHIIFEARTK
VNKGCANSGNLEWRVKNRRQKHIFGLSETTSDRYKRDVREATKYIETAIIIDKAMFDKRN
GSTRAEVVHDAIQVANIADLYFRTLNTRVSVVYIESWKGSNQAQIDNGIDIDQALLSFND
YTMRRMYQVAQDTTQLLTGETFSGGESGVAVPETVCSQRSVGISVDLNTYEPHLLAGTMA
HMIGHNIGMSHDDGRNDCNCRDWHGCIMAQSIVGLENVQPYKFSECSKTDYIEALKSGHG
ICLFNKPNELEIRRSCGNRVIDDGEQCDCGSIEECKEYDPCCDPITCKLTTEAECATGPC
CSDCKLRARGVVCRESTNECDLPEMCTGDTGQCPPDVYKKNGNPCANNAGHCFNGICPAL
DLQCEQVWGYGGIAADQECFEQFNSKGSINGHCGTDSSGHLIKCESENVRCGSLQCQQGS
KQPVIDGMKDLHTRTIISIKNQEYECKATNGRVEGSDIPGMGLVRDGTSCGDNLICVNQT
CTSLFPYIDQEKCPSNHDDKECSGNGVCTNVNKCHCFLGWSGPDCSIEQSIPTALPTTPP
TEVVVKSDSKLPEKKETPYENYHGSNTVFLVGMLMSVVGGVFVLFTLVALCYRSVVVHKN
FSLCLRRKSTVQKYDPPYSKKPQQKSYSGVSGNHHAEAAALDTVNKILTFGSMPQYREHK
PQPKRLGVEEEDGGTGAEEVVSFIDLPPNNLTKLPEKGILKKHGGYGLGGGAIEHVERTL
NQLNGYHEDILEVLKNAASRRDLVGTPSGSNLLDEDALRKSLAECGYPDVYRKDTDGQDN
GIDNGQEEEEDDVELQPPCGTIRIRNLEDLIRQLEHRASARPYMTGQMSPSGSEEIRTSE
TEPDRHYRIDSSVCSESSQGSRRCSRGRDEDASRFVYGRYRQPTSRSPYGNHQHTHQHSH
QMHPEDEGIYETADPDRGSNTRGETPDCESDAFIQAQQQVARWTSEDGGGGGGGGGVQHR
PPQQPPPPPAMPVQQQAQQQQHQLPVEQLPITQRGYYPSPPQIENNLDAGSNAEVESAQS
QQQSEVRGIDVNHTPNINKRPLDDNFSLDCNIMNNDSPKELITNNTSDNENTALLSHHFP
EYKH
Download sequence
Identical sequences F4X5Z5
Aech_17011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]