SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F5HC20 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F5HC20
Domain Number 1 Region: 2-102
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.06e-33
Family Thioltransferase 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F5HC20
Sequence length 104
Comment (tr|F5HC20|F5HC20_CRYNB) Thioredoxin {ECO:0000256|PIRNR:PIRNR000077} KW=Complete proteome OX=283643 OS=(Filobasidiella neoformans). GN=CNBC2990 OC=Cryptococcus neoformans species complex.
Sequence
MVKAIESYDEWKTLTSGSDVVVVDYWATWCGPCKMISPHFAKLEGKFPNVKFAKVDVEEQ
EDIAKEAQIKAMPTFVAYKDGKVIETVTGAVPAKINALLDKVAA
Download sequence
Identical sequences A0A225ZK74 A0A226BN91 F5HC20 J9VKF2 Q5KK55
XP_012048143.1.45702 XP_012048144.1.45702 XP_569667.1.95466 XP_776808.1.65578 CNAG_02801T0 sgtc|cn03304 214684.CNC04200 179.m00363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]