SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F5HCU1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F5HCU1
Domain Number 1 Region: 110-263,368-398
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-20
Family SPRY domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F5HCU1
Sequence length 618
Comment (tr|F5HCU1|F5HCU1_CRYNB) Uncharacterized protein {ECO:0000313|EMBL:EAL23450.1} KW=Complete proteome OX=283643 OS=(Filobasidiella neoformans). GN=CNBA1000 OC=Cryptococcus neoformans species complex.
Sequence
MSLENRLSPPLSRSETPALGTVGTVLDNATASLPLPNQNFPGEGLAGPGPSTTENHTKKV
IREDVERRQYARMGTIMPGTGDGLGIGEECFSWTDIPNVKNFRYHPCALSPTPSPHPVFP
FYRTIPYPPPIPPVHLSLLDRSSYLRISPSLLTIYNDRGFRSCRTNVSVREGTWYYEVHI
DRGDGEQGARRGAGGEGGNPHVRLGWGRREANLDTPVGCDAYSYAIRDVGGEKVHISRPK
PYANKGFRTGDIVGCLISLPRRPSLEDKPVSDPARIKRQRRAFNYKSQAYFESAEYTPSK
EMDALIDRDGKLAAAAKVESQAQEINGGDMPKKQMGATTKNTKKGKKQPEKAHEPVARKL
EKLSSSSISFFINGESFGEAFTDLYDFTPLPSLYPPVGGHGKKHHPGDEVLHDDGTLGYY
PMVSCFGRAKATCNFGPDFAHPLPEGARPMCERYAEFKEEERLLDEKDEVEDAERLRQIL
EAEKKMLSKVKPRNQKANSATASGENTPKRKKGPAPKRKREGRDGTEMSTPGVESVRGLT
ATPAPEAPMSEAGIEWREGTRERSMSVAASLGGQGWGTVKEEISDEREEKKIKKDKEVEV
KQENGGNSEDGEFEGINW
Download sequence
Identical sequences F5HCU1 Q5KPZ4
181.m08702 214684.CNA01030 XP_566535.1.95466 XP_778097.1.65578 sgtc|cn01104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]