SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F5XPV2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F5XPV2
Domain Number 1 Region: 19-200
Classification Level Classification E-value
Superfamily Prim-pol domain 3.07e-35
Family Bifunctional DNA primase/polymerase N-terminal domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F5XPV2
Sequence length 313
Comment (tr|F5XPV2|F5XPV2_MICPN) Uncharacterized protein {ECO:0000313|EMBL:BAK36783.1} KW=Complete proteome; Reference proteome OX=1032480 OS=NBRC 101784 / NCIMB 13414 / VKM Ac-1990 / NM-1). GN=MLP_37690 OC=Microlunatus.
Sequence
MAGQDALEVLAKAGRGWRLNHAAMLLAEGGVPVFPCAPGGKTPLIRDGQGFLDATTDKRQ
VRAWWRLHPWANIGIPTGAASGLVVVDVDVHRPVDGLRAFVRAGDAGLVKGWGLLVSTPT
GGQHAYFPAIPGVEQRSWQAGSVGIDFRGDGGYIIAPPSIRIIDGIASRYKVGGGEYLGQ
PLPVDSERLRDFLDPRPAPTHHAVPARDSDGADADRLAAWLSRQATDRNLKLFWASCRLA
EGGVPVTDAVDAMVTAAQSDFGEREITRTVHSAYRSVGAGARQRAPADAPGASADGFARC
DRAAPESASRGLS
Download sequence
Identical sequences F5XPV2
gi|336119409|ref|YP_004574186.1| WP_013864629.1.71618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]