SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F5Y9P8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F5Y9P8
Domain Number 1 Region: 25-152
Classification Level Classification E-value
Superfamily Cell wall binding repeat 0.00000000000275
Family Cell wall binding repeat 0.018
Further Details:      
 
Domain Number 2 Region: 528-549,598-649
Classification Level Classification E-value
Superfamily Cell wall binding repeat 0.00000361
Family Cell wall binding repeat 0.012
Further Details:      
 
Domain Number 3 Region: 978-1059
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000863
Family SMI1/KNR4-like 0.025
Further Details:      
 
Weak hits

Sequence:  F5Y9P8
Domain Number - Region: 737-845
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.034
Family GntR ligand-binding domain-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F5Y9P8
Sequence length 1102
Comment (tr|F5Y9P8|F5Y9P8_TREAZ) Uncharacterized protein {ECO:0000313|EMBL:AEF81667.1} KW=Complete proteome; Reference proteome OX=545695 OS=Treponema azotonutricium (strain ATCC BAA-888 / DSM 13862 / ZAS-9). GN=TREAZ_0780 OC=Bacteria; Spirochaetes; Spirochaetales; Spirochaetaceae; Treponema.
Sequence
MELYPFDDARPFTKAGPGLPALARVEKDKRWGYINTKGEMPIPLQFEVAGPFSEGLAPVM
LNGAWGYINTDGKLAVEPDLDWAGRFSCGLGSVKNRSKYYFIRSDGKPAFEGRFDDANPF
SEGLAAVVVDNKLGFIDTDGKTVIGFQYKNDDWLEDRHDFKEGFAIVQAEDGTVMYIDKS
GKALWSDRKEVNNVSSFSQGLAAVNLKGKGWGFINTSGEIAIPCAYEEAASFSDGLAWVE
KHYTRYVIDQTGKELLESYAGSFSEGLAFNKGDGFIDKSGAVVLPLEDIEAKAFAEGFAV
VKEDKKYGYIDKTGKPLDCVVRVAEKPADDTDDADAFIFESINHIAEERAAVKLDGKYAF
LDTSGLGPAGRFITPFMYKSASAFSEGLASVKIDKQRIFIDPEGKEVFTLEGRSSDEFVE
GMLRVYGDSGDGFVGRSGKITVPCIYDMTSNFSCGLAAVQKGKDWGFVNKKGEIAIPAVY
KGVWNFSEGFAAVDTGKKGKGFIDTTGKLVFKADFDAAHGFFQDRAGISKDDKWAVIDKT
GKLLTGYEFDSFENYSEGRALVSHGDWYGYIDVDCKVVIPFEYSKAESFSEGLAAVYKDG
RWGFIDQSGNTVISFDYNDAVSFSCGLAMVEKRGKYGYINTKGEAVISLRFAGASKRFVS
GIAAVQKGGAWGFIRKDGQLLRDYQFMTIAPADIILSDSDIHKLVHSHIAKKDIEAFTEA
VKTIPSRGKLSPDAIESLSINTGNILIANSRKKNPQEAFPLIETFVKLFGTAEYFRINTA
SVFIDNLKGHEDFYPEIKKAWLSSPLKKDEALGVYYLARDLADIGLHKEAMVELRRAVDA
GLTYWDVDPDIFPEAIRVELEPIKNELETVWKKQKEERDKDIEKEKVLTGSSETWWPLAA
ALVGDVDEKRRGLFTQHLAPWALTDECRALLDRLAERLTGTILKDNTLFIFFLNDKKKGV
KLTLAPPLQYISPKLADIPQSYLDLVTLHNGVTINDGVPEYPQICGVQGGEPLANIDDEW
DEARYKPFADAGQNWWFWDYVQKNALGEPLMVFCDHGEGIEAARPIHGQDVTAFGVGGLV
LRSLARTVFNTDEDLNYNYSWG
Download sequence
Identical sequences F5Y9P8
WP_015711187.1.50409 gi|333994464|ref|YP_004527077.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]