SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6AS62 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6AS62
Domain Number 1 Region: 31-215
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 3.16e-34
Family RNA methyltransferase FtsJ 0.0000292
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6AS62
Sequence length 217
Comment (tr|F6AS62|F6AS62_DELSC) rRNA (uridine-2'-O-)-methyltransferase {ECO:0000256|HAMAP-Rule:MF_01547} KW=Complete proteome OX=742013 OS=Delftia sp. (strain Cs1-4). GN=DelCs14_1925 OC=Comamonadaceae; Delftia.
Sequence
MKVNTKSKKVNKAWLNSHVNDPYVKAAQKDGYRARAAYKLKEIDEQLKLIRPGATVVDLG
STPGAWSQYVRRCLSPEGAAVGALNGRIISLDLLPMEPIEGVQFILGDFREEPVLAQLQE
ALGGGKADVVVSDMAPNLSGNGTTDAARIALLVELAVDFSIHHMKPEGALVVKLFHGGAY
DDLVALFRQTFKVVKPIKPKSSRDKSSETFLVGMGLR
Download sequence
Identical sequences A0A2G7TAD9 F6AS62
gi|333913568|ref|YP_004487300.1| WP_013801463.1.37708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]