SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6GXE7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6GXE7
Domain Number 1 Region: 32-294
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-88
Family Glycosyl hydrolases family 16 0.000000059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6GXE7
Sequence length 297
Comment (tr|F6GXE7|F6GXE7_VITVI) Xyloglucan endotransglucosylase/hydrolase {ECO:0000256|RuleBase:RU361120} KW=Complete proteome; Reference proteome OX=29760 OS=Vitis vinifera (Grape). GN=VIT_11s0052g01200 OC=Pentapetalae; rosids; Vitales; Vitaceae; Vitis.
Sequence
MAPICSSSSAVSTALLMSVVVSFLMAASAGNFYQDFDITWGDGRGKILNNGELLTLSLDK
PSGSGFQSKNEYLFGKIDMQLKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPY
ILHTNVFSQGKGNREQQFYLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNSESIGV
PYPKNQPMRIYSSLWNADDWATRGGLVKTDWSQAPFTASYRNFNANACLWSSGSSSCSST
SPSSTSTNGGWYSQELDSTSQERMKWVQKNYMIYNYCADTKRFPQGLPPECSATTMS
Download sequence
Identical sequences F6GXE7
XP_002273742.2.54126 29760.GSVIVG00031398001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]