SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6GY70 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6GY70
Domain Number 1 Region: 25-120
Classification Level Classification E-value
Superfamily Chaperone J-domain 3.66e-30
Family Chaperone J-domain 0.00025
Further Details:      
 
Domain Number 2 Region: 235-342
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000017
Family Thioltransferase 0.029
Further Details:      
 
Weak hits

Sequence:  F6GY70
Domain Number - Region: 475-601
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00101
Family PDI-like 0.075
Further Details:      
 
Domain Number - Region: 380-453
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00254
Family Thioltransferase 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6GY70
Sequence length 610
Comment (tr|F6GY70|F6GY70_VITVI) Uncharacterized protein {ECO:0000313|EMBL:CCB44906.1} KW=Complete proteome; Reference proteome OX=29760 OS=Vitis vinifera (Grape). GN=VIT_08s0217g00090 OC=Pentapetalae; rosids; Vitales; Vitaceae; Vitis.
Sequence
MKIRGVALSIVVFALWLLIFSQAAKTLDPYKVLGVDRNASQREVQKAFHKLSLQYHPDKN
KNKGAQEKFAQINNAYEILSDEEKRKNYDMYGDERGSPGFDAGNPGNNGGYTYFTSGGPG
GWQHMGGQGNSKSFSFSFGNSGGQGSSNFDLNDIFSNFFGGDKSGASHFGGFSGSSRTQS
GGFGGSSRSQSSGFSGSSRTQSGGFGGSSRSQSSGFSGTSWTQSGSGNYPKSIQDINSQV
FKKEIADQGITWLLLSYSPTLSGIQYYESIIEEVATSLQGALKAGSIYCENEPTFCKELG
IYPRKAPRVFVYSYKAIESGSLVEYKGDWATKNLKGFCQEHLPRFSKRVDLDTFDFSSGT
VERLPRVMLLSTKKDTPVIWRALSGLYRKRFIFYDVEVHDASDKVVKKLGVDALPAIVGW
MSNGEKHVLRTGISVKDLNSAIQELSTLLNGFEKKNKKATSSQTKKPETESVDKQIHLLT
ASNLDAICGETIPVCLIGVFRSSKAREKVESILSVVSQKSLSRRQNPYSGSKDSISYTLL
DATKQPAFLTAFDNSGFKSFDKLLIAYKSRKGKFAAYTSEITVEEVERFISSVLNGDIQF
TKIKQKPKLR
Download sequence
Identical sequences F6GY70

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]