SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6PIR0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6PIR0
Domain Number 1 Region: 365-472
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.23e-19
Family Spermadhesin, CUB domain 0.0034
Further Details:      
 
Domain Number 2 Region: 177-293
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.89e-16
Family Spermadhesin, CUB domain 0.0047
Further Details:      
 
Domain Number 3 Region: 3-125
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000157
Family Spermadhesin, CUB domain 0.0073
Further Details:      
 
Domain Number 4 Region: 123-186
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000027
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 5 Region: 477-535
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000118
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 6 Region: 537-599
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000278
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 7 Region: 604-663
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000223
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 8 Region: 298-363
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000157
Family Complement control module/SCR domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6PIR0
Sequence length 760
Comment (tr|F6PIR0|F6PIR0_MONDO) Seizure related 6 homolog like 2 {ECO:0000313|Ensembl:ENSMODP00000027725} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=SEZ6L2 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MVPPVLCNNNVSEGEGYVESPEFGRSAAPTLGPLDCTYSISVYPGYGIEIQVQSLNLSRE
EGLLVLAVGGAPAPTPQLLANASLLGEGQVLRSPTNRLLLHFRSPRTPRGGGFRIRYQAY
LLSCGFPPRPPHGDVSVTDLHPGGIATFHCDSGYQLQGEETLVCLNATRPAWSGEPPTCL
AACGGSIHNATLGRIVSPEPGGAVGPNLTCRWVIEAAEGRRLHLHFERVSLDEDNDRLVV
RSGGGPLSPLIYDSDMDDVPERGLISDAQSLYVELLSETPANPLLLSLRYEAFEEDRCFA
PFLAHGNVTSTDPQFRPGALATFSCLPGYALEPPGPPSAIECIDPSDPHWNDTEPACKAM
CGGELSESAGVVLSPDWPQSYSPGQDCIWGLHVQEEKRILLQVEILNVRGGDMLTLFDGD
SPSARVLAQLRGPQPRRRLLSSGPDLTLQFQAPAGPPNPGLGQGFVLHFKEVPRNDTCPE
LPPPEWGWRTASHGDLIRGTVLTYQCEPGYELLGSDILTCQWDLSWSAAPPACQKIMTCA
DPGEISNGHRTASDAGFPIGSHIQYRCLPGYSLEGAAVLTCYNRDTGTPKWSDRVPKCVL
KYEPCLNPGVPENGYQTLYKHHYQAGESLRFFCYEGFELIGEVTITCLPGHPSQWTSQPP
LCKGPGGVPGFWKGSENKEPEGRDPSRQMEGGNLALAILLPLGLVILLIGGVYLYYTKLQ
GKSLFGFSGSHSYSPITVESDFSNPLYEAGVSSNLAPVLL
Download sequence
Identical sequences F6PIR0
ENSMODP00000027725 ENSMODP00000027725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]