SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6PLC3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F6PLC3
Domain Number - Region: 3-132
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00818
Family DBL homology domain (DH-domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6PLC3
Sequence length 168
Comment (tr|F6PLC3|F6PLC3_MONDO) Sperm acrosome associated 9 {ECO:0000313|Ensembl:ENSMODP00000015723} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=SPACA9 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MNEVKELLRNIEQTYRLFQQQQFTFIAALEHCRENAHDKIRPITSIGQVQNYMEHYCNNS
TDHRILQMFLKICTELNRLCQQFENLHPGTPTTNNILEKCKILVSHSNDLSSLRARYPHD
VVNHLSCDEARNHYGGVVSLIPITVDLMKEWIAHSEKLPRKAAQHGAT
Download sequence
Identical sequences F6PLC3
ENSMODP00000015723 ENSMODP00000015723 XP_007475268.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]