SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6PN39 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6PN39
Domain Number 1 Region: 29-151,180-545
Classification Level Classification E-value
Superfamily Sema domain 4.58e-178
Family Sema domain 0.0000000000479
Further Details:      
 
Domain Number 2 Region: 608-690
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000845
Family I set domains 0.074
Further Details:      
 
Domain Number 3 Region: 541-592
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000453
Family Plexin repeat 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6PN39
Sequence length 772
Comment (tr|F6PN39|F6PN39_XENTR) Semaphorin 3F {ECO:0000313|Ensembl:ENSXETP00000059604} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=sema3f OC=Silurana.
Sequence
QLIDPILLTPTNSWPKTSINLPLPASTLWHTPLTDLKASGTAHFLSFLLNTTDYRILLKD
EDHDRMYVGSKDFILSLDLQDINREPLIIHWPASQQRIEECVLSGKDSNGECGNFIRLIQ
PWNRTHLYVCGTGAYNPVCTYINRGRKAQASELSHTPGGRGSRAADSLLSPTPADHKDYV
FYLEPDRVESGKGKCAYDPKLDSVSALINEELYSGVYIDFMGTDAAIFRAMGKQAAMRTD
QYNSRWLNDPAFVHVHLIPDSADRNDDKLYFFFREKSTDSPHSPTVYSRIGRVCLNDDGG
HCCLVNKWSTFLKARLICSVPGADGIETHFDELQDVFIQQTQDNKNPVIYAVFSSSGSVF
KGSAVCVYSMSDIRMVFNGPFAHKEGPNYQWMPYTGKIPYPRPGTCPGGTFTPSMKSTKD
YPDEVINFMRTHPVMYNPVYPVHRQPLLVRTNVNYRFTTIAVDQVDASDGRYEVLFLGTD
KGTVQKVIVLPKDDLETEELILEEVEVFKVPAPIKSMKISTKRQQLYVASMSGVTHVALH
RCDVYGEACADCCLARDPYCAWDGKTCSRYSASSKRRSRRQDVRHGNPMRQCRGYNSNAS
KNGVDGVQYGVEGSSAFLECQPRSPQAAVKWILQKDNTDRKKELRSEGRFLKTEQGLLMR
SLQLSDSGVYHCTATENSFKHTVMRVRLHVLGADAVTAALLQPEPPVALATNPAGPPGAY
DDLVQLLSQPEMGLLNQYCQGYWRPPGSTQTDAKEFQDQKRARNRRNHPPTG
Download sequence
Identical sequences F6PN39
ENSXETP00000059604 ENSXETP00000015932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]