SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6PNJ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6PNJ5
Domain Number 1 Region: 182-230
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000679
Family Ovomucoid domain III-like 0.0086
Further Details:      
 
Domain Number 2 Region: 252-307
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000097
Family Ovomucoid domain III-like 0.0071
Further Details:      
 
Domain Number 3 Region: 86-110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000398
Family Follistatin (FS) module N-terminal domain, FS-N 0.0024
Further Details:      
 
Domain Number 4 Region: 91-154
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000859
Family Ovomucoid domain III-like 0.00025
Further Details:      
 
Domain Number 5 Region: 20-58
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000549
Family TB module/8-cys domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6PNJ5
Sequence length 335
Comment (tr|F6PNJ5|F6PNJ5_HORSE) Follistatin {ECO:0000313|Ensembl:ENSECAP00000015558} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=FST OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
PGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTE
EDVNDNTLFKWMIFNGGAPNCIPCKETCDNVDCGPGKKCRMNKKNKPRCVCAPDCSNITW
KGPVCGLDGKYRNECALLKARCKEQPELEVQYQGCKKTCRDVNCPGSSTCVVDQTNNAYC
VTCNRICPEPTSSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQ
CTGGKKCLWDFKVGRGRCSLCDELCPDSKSEEPVCASDNATYASECAMKEAACSSGVLLE
VKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW
Download sequence
Identical sequences F6PNJ5
ENSECAP00000015558 ENSECAP00000015558 9796.ENSECAP00000015558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]