SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6PP72 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6PP72
Domain Number 1 Region: 30-110
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.18e-21
Family HLH, helix-loop-helix DNA-binding domain 0.00000739
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6PP72
Sequence length 142
Comment (tr|F6PP72|F6PP72_CALJA) MYC associated factor X {ECO:0000313|Ensembl:ENSCJAP00000036616} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=MAX OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MLSVKITSIFSIFFSLLFQEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSL
QGEKASRAQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQGEHPSLWGSWPCCAP
SRSGFGTWTCRVRASHGVCAEK
Download sequence
Identical sequences F6PP72
ENSCJAP00000036616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]