SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6PPT3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6PPT3
Domain Number 1 Region: 287-375
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 2.75e-35
Family Small-conductance potassium channel 0.0000829
Further Details:      
 
Domain Number 2 Region: 189-332
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.03e-25
Family Voltage-gated potassium channels 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6PPT3
Sequence length 427
Comment (tr|F6PPT3|F6PPT3_CALJA) Potassium calcium-activated channel subfamily N member 4 {ECO:0000313|Ensembl:ENSCJAP00000024637} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=KCNN4 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MGGDLVLGLGALRRRKHLLEQEKSLAGWALALAGIGIGLMVLHAEMLWFGGCSWALYLFL
VKCIISISTFLLLCLILAFHAKEVQLFMTDNGLRDWRVALTGRQAAQILLELAVCGLHPA
PVGGPPCAQGSGSPLTSLQPWPGFLSQGEALLSLAMLLRLYLVPRAVLLRSGVLLNASYR
SIGALNQVRFRHWFVAKLYMNTHPGRLLLGLTLGLWLTTAWVLSVAERQAVNATGHLSDT
LWLIPITFLTIGYGDVVPGTMWGKIVCLCTGVMGVCCTALLVAVVARKLEFNKAEKHVHN
FMMDIQYAKEMKESAARVLQEAWRFYKHTRRKESRAARRHQRRLLAAINAFRQVRLKHRK
LREQVNSMVDISKMQMILYDLQLNLSSSHRALEKQIDTLSGKLDTLTELLSTALGPRQLP
EPSQETT
Download sequence
Identical sequences F6PPT3
ENSCJAP00000024637 ENSCJAP00000024637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]