SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6PQ33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6PQ33
Domain Number 1 Region: 699-756
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.88e-26
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 475-532
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.8e-25
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 3 Region: 419-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 587-644
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.14e-23
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 5 Region: 643-700
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.97e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 4-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.59e-23
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 7 Region: 531-588
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.6e-23
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 8 Region: 365-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.79e-22
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 9 Region: 743-804
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.85e-20
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 10 Region: 326-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000975
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 11 Region: 211-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000411
Family Classic zinc finger, C2H2 0.047
Further Details:      
 
Domain Number 12 Region: 259-311
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000896
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Weak hits

Sequence:  F6PQ33
Domain Number - Region: 793-828
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000265
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6PQ33
Sequence length 851
Comment (tr|F6PQ33|F6PQ33_MACMU) Zinc finger protein 484 {ECO:0000313|Ensembl:ENSMMUP00000003213} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=ZNF484 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MTKSLESVSFKDITVDFSRDEWQQLDLAQKSLYREVMLENYFNLISVGCQVPKPEVIFSL
EQEEPCMLDGEISGQSHPDGDIGFGPLQQRMSDEISFQSEININLFKRDDPYSILEEVWK
DDEHTRKCGENQNKLLSHVAFINKKTLANDRVCEYKDIGEIVHVNTHLVSSRKRLHNCNS
FGKNLEPIVTLYNRNDATENSDKTIGDGDIFTHMNSHTEVTACECNQCRKSLHHKQALIQ
HQKIHTRERLYLFSDYVNVFSPKSHAFAHESICTEEKQHECHEREAVFTQKSQLDGRQRV
YAGICTEYEKDFSLKSNHQKTPEGNYYKCSDYGRAFIQKSDLFRCQRIHSGEKPYEYSEC
EKNLSQNSNLNIHKKIHTREKHFECTECGKAFTRKSTLSMHQKIHTGEKPYVCTECGKAF
IRKSHFITHERIHTGEKPYECSDCGKSFIKKSQLHVHQRIHTGENPFICSECGKVFTHKT
NLIIHQKIHTGERPYICTVCGKAFTDRSNLIKHQKIHTGEKPYKCSDCGKSFTWKSRLRI
HQKCHTGERHYECSECGKAFIQKSTLSMHQRIHRGEKPYVCTECGKAFFHKSHFITHERI
HTGEKPYECSICGKSFTKKSQLHVHQQIHTGEKPYRCAECGKAFTDRSNLFTHQKIHTGE
KPYKCSDCGKAFTRKSGLHIHQQSHTGERHYECSECGKAFARKSTLIMHQRIHTGEKPYI
CTECGKSFIQKSHLNRHRRIHTGEKPYECSDCGKSFIKKSQLHEHHRIHTGEKPYICAEC
GKAFTIRSNLIKHQKIHTKQKPYKCSDLRKALNWKPQLSMPQKSDTGEVECSMLQLWCGD
SGGDQGQLSSV
Download sequence
Identical sequences F6PQ33
ENSMMUP00000003213 ENSMMUP00000003213 9544.ENSMMUP00000003213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]