SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6PQT7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F6PQT7
Domain Number - Region: 181-223
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0288
Family Frizzled cysteine-rich domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6PQT7
Sequence length 486
Comment (tr|F6PQT7|F6PQT7_CALJA) Glypican 4 {ECO:0000313|Ensembl:ENSCJAP00000007603} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=GPC4 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MEEKYSLQSKEDFKSVVSEQCDHLQAVFASRYKKFDEFFKELLENAEKSLNDMFVKTYGH
LYMQNSELFKDLFVELKRYYVVGNVNLEEMLNDFWARLLERMFRLVNSQYHFTDEYLECV
SKYTEQLKPFGDVPRKLKLQVTRAFVAARTFAQGLAVAGDVVSKVSVVNPTAQCTHALLK
MIYCSHCQGLVTVKPCYNYCSNIMRGCLANQGDLDFEWNNFIDAMLMVAERLEGPFNIES
VMDPIDVKISDAIMNMQDNSVQVSQKVFQGCGPPKPLPAGRVSRSISESAFSARFRPHHP
EERPTTAAGTSLDRLVTDVKEKLKQAKKFWSSLPSNVCNDERMAAGNSNEDDCWNGKGKS
RYLFAVTGNGLANQGNNPEVQVDTSKPDILILRQIMALRVMTSKMKNAYNGNDVDFFDIS
DESSGEGSGSGCEYQQCPSEFDYNATDHSGKSANEKADSAGVRPGTQAYLLTVFCILFLV
MQREWR
Download sequence
Identical sequences F6PQT7
ENSCJAP00000007603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]