SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6PRC0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6PRC0
Domain Number 1 Region: 283-333
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.07e-17
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 323-383
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000143
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 3 Region: 241-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000249
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 4 Region: 154-178,206-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000442
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Weak hits

Sequence:  F6PRC0
Domain Number - Region: 383-408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00183
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number - Region: 1005-1029
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0124
Family Classic zinc finger, C2H2 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6PRC0
Sequence length 1043
Comment (tr|F6PRC0|F6PRC0_XENTR) RE1 silencing transcription factor {ECO:0000313|Ensembl:ENSXETP00000011684} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=rest OC=Silurana.
Sequence
MATQMVNQPTGNSLFCTSTYSSISLDNDMYGLHDLSKADMAAPRLIMLANVALTGELSSG
CCDYTLEGERQMAELTTVNDNSFSDSEGERLEDSPSNAIQSPNFTMEMEPAERSKEGTYE
NDGTLLSSTLEVVAQKDNEAPSTTEDKNKCIKSKPFRCKPCQYKAESEEEFVHHIKIHSA
KIYTDNDNKKTQGKESDSNIPEESDISKGPIQCDRCGYNTNRFDHYLAHLKHHNKAGENE
RVYKCTICTYTTVSEYHWKKHLRNHYPRILYTCSQCSYFSDRKNNYIQHIRTHTGERPYQ
CIICPYSSSQKTHLTRHMRTHSGEKPFKCEQCSYVASNQHEVTRHARQVHNGPKPLTCPH
CDYKTADRSNFKKHVELHVNPRQFLCPVCDYAASKKCNLQYHIKSRHSGCTNITMDVSKV
KLRTKKGEVGVADTDTNKQTENGNIIKKKLEETVKAEKKERCVKSKKRMIDGQVAKKSRL
SSTQKKIKASEVRAEKIEKFRKSSCVKRKADLLENPSDTLTSTVKKKKLKNSPASKVITS
EIKDDIPKKVKGLVKKKENSAVKSKHKKKTGAQSSNGKRNMPKKITEQKVDKTSADLPLE
HGDPSATHLVSRGTPSCDHPVNCGESLCGQHVDEQPCSQLVDVEEPTCNHLQGGDEPAFV
LVTGRDEPARIPPPDGDEPAYVPLLGGDEPACILPLGGDEPACILPLDRDEPACVPVPGG
DEPACVPPRVGDEPACVPPRVGDEPACVPPPGVDEPACVPPPGGDEPACVPPPGGDEPTD
LLRKTTCLSVDRQEVTDLVGREKHYALLTECNEPTDLSAERDVLSVDDAMPTDLSTKRSN
KPSELSVVWGEPVDLSVGRSEPADLSVGRSQPANLQMSITETMDLLEGSQLSVLTVGSDV
ESFDMGTVERCEPIDLSVEKGMPASSHTENSGAEEVQTTQMQCAVSRSESIDIDEDEGIH
SHDGSDISDNVSEMSYDSGLNGVPSVQKTLTSDSKVLDSSETKESFVCIFCDRTFRIEEE
YTKHLKRHLVNVYYLEKAAKDDL
Download sequence
Identical sequences F6PRC0
ENSXETP00000011684 ENSXETP00000011684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]