SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6PVD0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F6PVD0
Domain Number - Region: 33-104
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00282
Family Canonical RBD 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6PVD0
Sequence length 104
Comment (tr|F6PVD0|F6PVD0_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000010851} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MGVYGQESGGFSGPGENWSMSGPDNQGRGRGEFDHGGMIRGGRGGGGGGRGGMRAGEYGG
PMEEGPDLDLGPPVDPDEDSKNSAIYVQELNESVTADKMADFFK
Download sequence
Identical sequences F6PVD0
13616.ENSMODP00000010851 ENSMODP00000010851 ENSMODP00000010851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]