SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6PX02 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6PX02
Domain Number 1 Region: 210-290
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.44e-26
Family PHD domain 0.00046
Further Details:      
 
Domain Number 2 Region: 351-682
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.31e-24
Family Hect, E3 ligase catalytic domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6PX02
Sequence length 690
Comment (tr|F6PX02|F6PX02_XENTR) G2/M-phase-specific E3 ubiquitin protein ligase {ECO:0000313|Ensembl:ENSXETP00000030968} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=g2e3 OC=Silurana.
Sequence
MSRIRRKSSKNLPCVFCGLSDDCAEKFGEKKTYPEHDLTLHYYCLLLSSGIWQRGKENEG
IYGFLVCDIKKEVNRANKLRCALCKNRGASIGCVFPKCRRSYHYHCGVKKECIFQFTDSF
RSYCWEHRPVQKIVSSQTDCSSTCTICLENVNHVSSYHILRSPCCKTSWFHRNCLQHQAL
SAGLFFFRCTVCNNKDIFQNEMLRMGIHIPERDASWELEENAFQELLVRYQRCDAKKCVC
RGGREYNEPENKWEIVRCQCCGSSGTHRACSSIGELDQSWECPDCCSVVSTPGKRSRPAS
LAQSDQLGCLGFGMESSPKCPRLSTTPKGKVLLRHISTQERTISDILHNLRLQINTDSVC
TMLIQKECLWQSSLECFRNSNFCPSSTLRVKFTKHKFRMECKQPNGSLSEYFGLLLNTVR
NSPLLEGSEHKNIALNLEALEDNLYFEAGRMVALALVHGGPAPGFFSQTLFRCLIYDPQH
VLPAVEDVADPNVAQAILTIQSCQRIGTLKSAIIHYFDYLQKTGSLRLVQTVSDKVLIIK
ELLAHHVIRRVQQPLESFKQGLMTLGVLEKIQAHPAIFWSVLVLGPEKLTAKSMTDLFTV
THTDLGVKQQSDALGFWVDYLEDTEEGTTVCSLEDILNFATGLPSVPPAGFDPRPSIRFK
QMAQPKARKYINCLELPSFSSYLDFTRSMN
Download sequence
Identical sequences F6PX02
ENSXETP00000030968 ENSXETP00000030968 8364.ENSXETP00000030968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]