SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6PYF0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6PYF0
Domain Number 1 Region: 116-168
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000000000981
Family Hairy Orange domain 0.0000529
Further Details:      
 
Domain Number 2 Region: 50-127
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000628
Family HLH, helix-loop-helix DNA-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6PYF0
Sequence length 308
Comment (tr|F6PYF0|F6PYF0_CALJA) Hes related family bHLH transcription factor with YRPW motif 1 {ECO:0000313|Ensembl:ENSCJAP00000000819} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=HEY1 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MKRAHPEYSSSDSELDETIEVEKESADENGNLSSALGSMSPTTSSQILARKRRRGIIEKR
RRDRINNSLSELRRLVPSAFEKQVMEQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAH
ALAMDYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLG
HIPWGTAFGHHPHIAHPLLLPQNGHGNAGTTASPTESLHQGRLASAHPEAPALRAPPSGS
LGPVLPVVTSASKLSQPLLSSVASLSAFPFSFGSFHLLSPNALSPSAPTQATNLGKPYRP
WGTEIGAF
Download sequence
Identical sequences F6PYF0
XP_008981065.1.60252 ENSCJAP00000000819 ENSCJAP00000048892 ENSCJAP00000000804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]