SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6PZI4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6PZI4
Domain Number 1 Region: 654-816
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.41e-43
Family Ypt/Rab-GAP domain of gyp1p 0.0014
Further Details:      
 
Domain Number 2 Region: 794-911
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 7.06e-26
Family Ypt/Rab-GAP domain of gyp1p 0.0099
Further Details:      
 
Domain Number 3 Region: 79-185
Classification Level Classification E-value
Superfamily PH domain-like 9.04e-21
Family Pleckstrin-homology domain (PH domain) 0.0036
Further Details:      
 
Weak hits

Sequence:  F6PZI4
Domain Number - Region: 417-467
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0193
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6PZI4
Sequence length 965
Comment (tr|F6PZI4|F6PZI4_MONDO) TBC1 domain family member 2 {ECO:0000313|Ensembl:ENSMODP00000015682} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=TBC1D2 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MKPGSPGGPWLPLAPGAETAPPSTLTLEMETPRESGWPAPDEAPLEPVSGNDPCPVSEKG
AATPEDPEAALYKSGKEVMGENTKLCGYLLKFGGKGPIKGWKSRWFFYDERKCHLYYSRT
AQDVNPLGSIDLSCVTFDCKVEAEEGTFEIKTPSRVITLKAVNKQTMMYWLQQLQLKRWK
FYNSQPGILVSGVTNETSPGNASPLHITLDLDNTETDEFFCPVKTPTGLVGIAAASQPIP
EMPSTLQNISLKHLGTEIQNTMHIICSNRQSRGNGHVSQGDESQKFEENQNEEQHLQADP
GLTGKETEEYSRSTQKSGLTANFIQKAKKQNSSFPIFAEGLREKSFQDKVGVLEQQVMML
SEELKSQKELVKILHKALEAAQQEKRTCSTYLTATEDKDRLELVRHKVRQIAELGKRVES
LQQDKKALEQTLGLREEHIKELEQHVQLLMDKNHAKQQVIFKLTEKVTKDFIDPPTSADG
LESGTFLNPYEKIEHLKDDIEAYRTQNRFLNSEIHQVTKIWRNAAEKEKVLLMKCAYLQA
KNCQIESKYLTVLRKLQDTLPIDDSEYGEMLKKLIHEALQWDVKEGATDSMKFNPVSEYD
DYGFMTVPDYEVEDLKLLAKIQALEIRSNNLLNHEAVEKPLREKWNSIGELMPSADLKHL
IRSGIPPEHRQRVWKWMISLRVKPIQAPNHYDSLLRKCETMEHPAFRQIELDLNRTLTNN
KHFTNPTSKFISKLRRVLLAFSWQNPTIGYCQGLNRLAAIALLILEEEESAFWCLVCIVE
TIMPADYYSKTLIASQVDQRVLQDFLSEKLPRLMAHLGQHKIDLSLITFNWFLVIFVDNL
ISDILLRVWDAFLYEGIKVIFRYALAIFKYNEEAILRIHDSLEIYQYLRFFTKTICNGRK
LMNIAFNDMNPFPMKQLRNRRAVHREKLETELGELEHIKAEFLKERARQESKLLEGCMSE
DEEET
Download sequence
Identical sequences F6PZI4
XP_007499033.1.35504 ENSMODP00000015682 ENSMODP00000015682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]