SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6Q0N5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6Q0N5
Domain Number 1 Region: 29-228
Classification Level Classification E-value
Superfamily p53-like transcription factors 7.95e-80
Family STAT DNA-binding domain 0.00000000437
Further Details:      
 
Domain Number 2 Region: 788-999
Classification Level Classification E-value
Superfamily p53-like transcription factors 4.64e-74
Family STAT DNA-binding domain 0.00000000694
Further Details:      
 
Domain Number 3 Region: 605-787
Classification Level Classification E-value
Superfamily STAT 5.69e-59
Family STAT 0.0000000146
Further Details:      
 
Domain Number 4 Region: 229-360
Classification Level Classification E-value
Superfamily SH2 domain 5.92e-42
Family SH2 domain 0.000000339
Further Details:      
 
Domain Number 5 Region: 470-589
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 6.28e-42
Family Transcription factor STAT-4 N-domain 0.0000261
Further Details:      
 
Domain Number 6 Region: 1051-1137
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000000124
Family SH2 domain 0.0000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6Q0N5
Sequence length 1177
Comment (tr|F6Q0N5|F6Q0N5_XENTR) Signal transducer and activator of transcription {ECO:0000256|RuleBase:RU046415} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=stat3.1 OC=Silurana.
Sequence
VSYKGDPIVQHRPMLEERIVELFRNLMKRLLVKFPELNYQLKIKVCIDNSRKFNILGTNT
KVMNMEESNNGSLSAEFKHLASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNI
CQMPNAWASILWYNMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTT
LAEKLLGPGVNYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMG
FISKERERAILSTKPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNN
MSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHQEPTDPGIYKYAP
DFPSSWAAKYGALKSVLSLWCLLRSRKNLMTGGSGYIQFVRHSGSAPLCLPIVCQTKFFF
LSKVVFLFFNRMHYPLNRKHACDSPVWHYLAIWYIYITAQQSACYLAHKMAQWNQLQQLD
TRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAFAASKESHATLVFHNLLGEIDQQYSRF
LQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEEGRLLQTAAAAAQQGGPASH
PTAAVVTEKQQMLEQHLQDVRKKVQDLEQKMKVVENLQDDFDFNYKTLKSQSDLSELNGN
NQSVTRQKMQQLEQMLTALDQLRRTIISDLASLLSAMEYVQKNLTDEELADWKRRQQIAC
IGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQHRPMLEERIVE
LFRNLMKRLLVKFPELNYQLKIKVCIDKDSGEGAALRGFFSFKNICRYIKISRKFNILGT
NTKVMNMEESNNGSLSAEFKHLTLREQRCGNGGRANCDTHSLPVVVISNICQMPNAWASI
LWYNMLTNNPKNVNFFTKPPIGTWDQTAEVLSWQFSSTTKRGLSIEQLTTLAEKLLAGPG
VNYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGCHVVPKCKFLQFL
SDRFFLPSIPSSSRKFNILGTNTKVPIVISHPGKTQIQSVEPYTKQQLSSMSFAEIIMGY
KIMDATNILVSPLVYLHPDIPKEEAFGKYCRPESQEHQEPTDPGTAPYLRTMFICVTPSR
STTFQWDERLYLPMSPGTFDSVMQFPGEGEESCVRNQ
Download sequence
Identical sequences F6Q0N5
ENSXETP00000016634 ENSXETP00000016634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]