SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6Q1G5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6Q1G5
Domain Number 1 Region: 912-1022
Classification Level Classification E-value
Superfamily SEA domain 1.7e-18
Family SEA domain 0.0086
Further Details:      
 
Domain Number 2 Region: 246-339
Classification Level Classification E-value
Superfamily SEA domain 0.00000000000863
Family SEA domain 0.0075
Further Details:      
 
Weak hits

Sequence:  F6Q1G5
Domain Number - Region: 1071-1114
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0133
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6Q1G5
Sequence length 1254
Comment (tr|F6Q1G5|F6Q1G5_HORSE) Interphotoreceptor matrix proteoglycan 2 {ECO:0000313|Ensembl:ENSECAP00000018964} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=IMPG2 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MIMFPHFGKISLGILIFVLIEGNLPSLTEEIQEPESAVSFLLTNSASTDPSLSTAKRGPL
DHGEAERRWLLRRRRSLFPNGVKTCPDESVSEAVANHVKYFKVRVCQEAVWEAFRTFWDR
LPGREEYRYWMNLCEDGVTTILEMATNFSESVEHRSLIMKKLTYTKEPVSSSCNDQACGL
ELSSPVPVGDTSTLGGAVLSVRYPEMTSYEGAWESSLERPEESISNEIENVIEEPTKAAA
EQIAEFSVHLTGEQYKEELQDPSSFYHQHLVEEFISEVENAFSGLPGYKGIRVLDFRSPK
DNGRGIDVHYAVTFNGEAISNTTWDLISLHSNKVENHGLVELDDKPTAVYTISNFRDYIA
ETLHQNFLLGNSSLNPDPDSLQLINVRGVLLPQTEDLVWNTQRSSLQATPPSILDNTLQA
EWLSADESTTRSVSPLDFSSGPPSATGRERWSESPGGDLMSTPKLAFSSKVGLSSSVGVL
EVSSLTLDSVTTAALQTGLPVASEERTSGSYLLGDGLTEVEELEDFLSIDPLPSGSFTHP
VPKETVPSMEDSGVSLTSSPYQVSSVTLDLLDKEITTPFGLDSLTSKVKGQLEVSTLMPD
ISMDKEFIFESGLGSGSGQKVNLITWPWSETSPEKSTEPLSKSWLEDGDSLLPTEDVDER
LGIDDKIDSTHQSIEHSEYGDFDRSPSFVEEEPLGGPAVPIFAAETTTQSASLILSKHTS
EISDVDHYSITKAPPPLTSTAISASTDKPDQVEPFLKEDMEQTTESSNSEWFDSKVSVVK
PSMQPLWTTLPESEVVWAKTSSPEKLSRDTLAGTPQSTDKLWLKASVTQSAKLPPTTSST
LLEDEVIMGVQDISLELDHMGTGYYQPELIPEENGKAGSYMEMSTNVHSTELAIVAWPTK
GGDLSHNQTTGALVVFFSLRVTNMMFSEDLFNKNSLEYKALEQRFLELLVPYLQSNLTGF
QNLEILNFRNGSVVVNSRVKFAKSVPRNVNNAVYMILEDFCTTAYQTMNLAIDKYSLDVE
SGDQANPCKFQACNEFSECLVNPWSGEAECRCYPGYQSVKELPCQSLCDLQPDFCLNDGK
CDIIPGHGAICRCRVGDNWWYRGEHCEEFVSEPWVIGIAVASLVGLLLISSAVVFVLVKM
LQAQYVRRERERPFRKSRQPDSLSSIENAVKSNPVYERRVVGLEQCRGAYPQHPFCSSAG
GEVMGGLSREEIRQMYENSELSREEIQERMRILELYASDPKFAAFVRQHQMEKL
Download sequence
Identical sequences F6Q1G5
ENSECAP00000018964 ENSECAP00000018964 9796.ENSECAP00000018964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]