SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6Q347 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6Q347
Domain Number 1 Region: 541-666
Classification Level Classification E-value
Superfamily PH domain-like 5.89e-19
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Domain Number 2 Region: 84-266
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000124
Family Clathrin adaptor core protein 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6Q347
Sequence length 720
Comment (tr|F6Q347|F6Q347_HORSE) Engulfment and cell motility 2 {ECO:0000313|Ensembl:ENSECAP00000010903} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=ELMO2 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MPPPSDIVKVAIEWPGANAQLLEIDQKRPLASIIKEVCDGWSLPNPEYYTLRYADGPQLY
ITEQTRSDIKNGTILQLAISPSRAARQLMERTQSSNMETRLDAMKELAKLSADVTFATEF
INMDGIIVLTRLVESGTKLLSHYSEMLAFTLTAFLELMDHGIVSWDMVSITFIKQIAGYV
SQPMVDVSILQRSLAILESMVLNSQSLYQKIAEEITVGQLISHLQVSNQEIQTYAIALIN
ALFLKAPEDKRQDMANAFAQKHLRSIILNHVIRGNRPIKTEMAHQLYVLQVLTFNLLEER
MMTKMDPNDQAQRDIIFELRRIAFDAESDPSNVPGSGTEKRKAMYTKDYKMLGFTNHINP
AMDFTQTPPGMLALDNMLYLAKFHQDTYIRIVLENSSREDKHECPFGRSAIELTKMLCEI
LQVGELPNEGRNDYHPMFFTHDRAFEELFGICIQLLNKTWKEMRATAEDFNKVMQVVREQ
ITRALPSKPNSLDQFKSKLRSLSYSEILRLRQSERMSQDDFQSPPIVELREKIQPEILEL
IKQQRLNRLCEGSSFRKIGNRRRQERFWYCRLALNHKVLHYGDLDDNPQGEVTFESLQEK
IPVADIKAIVTGKDCPHMKEKSALKQNKEVLELAFSILYDPDETLNFIAPNKYEYCIWID
GLSALLGKDMSSELTKSDLDTLLSMEMKLRLLDLENIQIPEAPPPVPKEPSSYDFVYHYG
Download sequence
Identical sequences F6Q347
9796.ENSECAP00000010903 XP_001503481.1.31192 XP_008519855.1.77740 XP_008519856.1.77740 XP_014715403.1.49734 XP_014715404.1.49734 ENSECAP00000010903 ENSECAP00000010903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]