SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6Q3S2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6Q3S2
Domain Number 1 Region: 108-231
Classification Level Classification E-value
Superfamily SH2 domain 4.98e-29
Family SH2 domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6Q3S2
Sequence length 236
Comment (tr|F6Q3S2|F6Q3S2_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000003647} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MFLFSAEFQRQESVKSQNKGVQLYDTPYEPEGNGVDSDSESLVSQRLRESKLPQDDDRPA
DEYDQPWEWNKVTIPALAAQFNGNEKRQSSPSPSRDRRRQLRAPGGGFKPIKHGSPEFCG
ILGERVDPTVPLEKQIWYHGAISRTDAENLLRLCKECSYLVRNSQTSKHDYSLSLKSNQG
FMHMKLTKAKEKYILGQNSPPFDSVPEVIHYYTTKKLPIKGAEHLSLLYPVAVRTL
Download sequence
Identical sequences F6Q3S2
ENSMODP00000003647 13616.ENSMODP00000003647 ENSMODP00000003647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]