SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6Q400 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6Q400
Domain Number 1 Region: 43-158
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.05e-27
Family Canonical RBD 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6Q400
Sequence length 179
Comment (tr|F6Q400|F6Q400_MONDO) Small nuclear ribonucleoprotein U11/U12 subunit 35 {ECO:0000313|Ensembl:ENSMODP00000015618} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=SNRNP35 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MNEWMPIAKEYDPLKAGSIDGTDEEPHDRAIWRAMLARYVPNKGVSGDPHLTLFVGRLNL
QTTEEKLKDVFSRYGDIRKLRLVRDVVTGFSKRYAFIEYKEERSLLKAYRDANGLVIDQH
EIFVDYELERILKGWIPRRLGGGFGGKKESGQLRFGGRDRPFRKPINLPVFKSDFYGEG
Download sequence
Identical sequences F6Q400
ENSMODP00000015618 13616.ENSMODP00000015618 ENSMODP00000015618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]