SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6Q5H8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6Q5H8
Domain Number 1 Region: 154-294
Classification Level Classification E-value
Superfamily ADP-ribosylation 4.53e-25
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.079
Further Details:      
 
Domain Number 2 Region: 30-148
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.21e-24
Family ADP-ribosylating toxins 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6Q5H8
Sequence length 303
Comment (tr|F6Q5H8|F6Q5H8_XENTR) Uncharacterized protein {ECO:0000313|Ensembl:ENSXETP00000061884} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN= OC=Silurana.
Sequence
HSVGIFESSLQKRAVINFSMHYKIILQSNAQPRDGKIYVMYHGTTLAAAIQIIQNGFKQS
ADGMLGRGVYVSRDMDKAARYPLRDQSQQVILKLRVNVGKVKMINYQGHPLQKTWHDHGY
DTAWVPASCGMVPSQLEEDCIWDPKRIKVVGIAKIFKENISEQYNHLFLQSNHHPRDRNI
YVMYHGTTVAAATQIIKHGFKQSADGMLGRGVYVSRDKDKAARYPLDDQSDQVVLKLRVN
VGRVKKIDCQGHPLQKTWHDHGYDTAWVPSCSGMVPSQLEEDCIWDPRRIKTLIKGDCVD
MKE
Download sequence
Identical sequences F6Q5H8
ENSXETP00000061884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]