SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6Q714 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6Q714
Domain Number 1 Region: 886-1090
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.07e-47
Family DBL homology domain (DH-domain) 0.00018
Further Details:      
 
Weak hits

Sequence:  F6Q714
Domain Number - Region: 283-336
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000143
Family Motor proteins 0.014
Further Details:      
 
Domain Number - Region: 84-116,144-298
Classification Level Classification E-value
Superfamily ARM repeat 0.00141
Family MIF4G domain-like 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6Q714
Sequence length 1283
Comment (tr|F6Q714|F6Q714_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000022786} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MESTTVDPRILSIAAEVTESPEQNVPVILLKLKEIINSAPLGSSELKKIKQDIYCYNLIQ
YCLLVLRKDGAKIQGGWVTISQLAQILSQCCVGLEPKEEAEEFYNKLLPSAADNFLTLGR
RLQKCYISAVKDEEKDEFLWHFQSVIDSLCWLLGGHIQLTKYVLQSDHFLHLLQTDDIKT
GSSIMTVLQNILQVKSGDFLMIKEKAFHSILDELIFKLSSSTCLVIGSAAIKLLLLLASS
HPEIIMLLNSRYTGLKSILNKQCSGKEIDQEVKQLFSLLHSEVCHEDQKFYQAACKIQAA
WKGFQTRKRMKKLPYAVTTLQRNFRNKREKQLLKLKKQKEEKDLKLQLQLQRQRAMRISR
ECRLNLLEIVHPGQMGKYIQEMEEKSALVIQKYWRGYRERKNFCQQKQSLQEYKAAVILQ
RAALTFLRKCHKRKKMSNSWQGLPGLTDARRMELKQHVDNYIKRHSASEMSHVASRELHT
EAQERLGHYFLGRALEERAQQRREALQAQISTNIEQLMSAPNLRETTGQEPELFISRSRP
VATRAKQAHLATLMERQAPWWKKLEDEFTDLKLRTLAFGDRSQLLCEPVGLNLPTWKTKP
QATVENPESLQAVNDCVFDRGGKEDAMCLAFGSLCSTYPFSASAHLHKSPLSCTPIVAVK
SPSWSQEPQDVGSTTLDNNSRFVEAPIATQICWKEMKDKIAKDTHLVEWTLSSNCHCSSL
NNPLESSKSPQECQPQPHFSGSTPMTNNWKKQLELKSAATIHQHMKKWQTKKNPELPGVP
HGWKLDENNCSLPAKQHWNNMDHLSTGNQVTGLCEGQDENEPCGDQEPGPALRAGAAEAE
QEDPGLESALAPSWRSQASTVSNSPEAHCTDCREEKEALSPGHRSLCGQCTKLRWERKQA
VLEFIQTEASYGENLRVIKEQFQLPMQSAGLLSPGQLLAVFSNIQELIDLNEKFLESLKE
EIAEALSQGDDDLMNVCVGGIFLKYVNMLPAFQTYCLQQASSISTLSTLEKEKELLRIFL
HASQTNNTALRRMNLRSFLMAPLQRITKYPLLLSRITQATATFHPDYSHLCEATSHLASY
LEHINRKTRQEGSLPWALRPFRQDVCHHHEAIAAIDRRELALKTLGWLWEETRFVMEGGL
QLAQLPDGPWTRKGSRTLKFQTLQVILMARLQKSAEIGSRHGSLGQGPVGDAALVLIRDK
SHGKLNLVRSPVRLGQCVVSADPVCKTFELLEIQQGALILRDEDYARTQLWLYHIRVYAR
QLGSWKRRRNALPNIMINIPNHP
Download sequence
Identical sequences F6Q714
ENSMODP00000022786 ENSMODP00000022786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]