SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6Q8R0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6Q8R0
Domain Number 1 Region: 179-227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000229
Family EGF-type module 0.016
Further Details:      
 
Domain Number 2 Region: 124-271
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000659
Family Growth factor receptor domain 0.013
Further Details:      
 
Weak hits

Sequence:  F6Q8R0
Domain Number - Region: 64-122
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 0.0706
Family Creatinase/aminopeptidase 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6Q8R0
Sequence length 546
Comment (tr|F6Q8R0|F6Q8R0_HORSE) Oncoprotein induced transcript 3 {ECO:0000313|Ensembl:ENSECAP00000006979} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=OIT3 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MPQFLLLTCLFITITPVSPRALDPCSAYISLNEPWRNTDHQFDESQGPPLCDNHVDGEWY
RFTGMAGDAMPTFCIPENHCGTHAPVWLNGSHPLEGDGIVQRQACASFNGNCCLWNTTVE
VKACPGGYYVYRLTRPSVCFHVYCGHFYDICDEDCHGSCLDPSDCTCSPGTVLGPDRQTC
FDENECEQNNGGCSEICVNLKNSYRCECGAGRVLKSDGKTCEDIEGCHNNNGGCSHSCLM
SEKAYQCECPRGLVLSEDNHTCQVPVLCKSNTIEVSIPRDLVGGLELFLTNTSCRGVSNG
THVNILFSLKTCGTVVDVVNDKIVASNLVTGLPKQTPGSSGDIIIRTSKLLIPVTCEFPR
LYTISEGYVPNLRNTPLEIMSRSHGIFPFTLEIFKDNEFEEPYREALPTLKLRDSLYFGI
EPLVHVNGLESLVESCFATPTSKIDEILKYYLIRDGCVSDDSVKQYTSRDHLAKHFQVPV
FKFVGKDHKEVFLHCRVLVCGMLDERSRCAQGCHRRMRREAVEGEDTAGPQSQMLTGGPI
SIDWED
Download sequence
Identical sequences F6Q8R0
ENSECAP00000006979 9796.ENSECAP00000006979 ENSECAP00000006979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]