SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6Q970 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F6Q970
Domain Number - Region: 228-261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.017
Family EGF-type module 0.073
Further Details:      
 
Domain Number - Region: 363-410
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0653
Family Laminin-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6Q970
Sequence length 1040
Comment (tr|F6Q970|F6Q970_HORSE) Platelet endothelial aggregation receptor 1 {ECO:0000313|Ensembl:ENSECAP00000018943} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=PEAR1 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MSPPLHSLLLLALGLGLAGTLNPNDPNTCSFWESYTTTTKESHTRPFSLLPSEPCDRPWE
SPHTCPRPTVVYRTVYRQVVKTDHRRRLQCCRGFYESSGACVPLCAQECVHGRCVAPNQC
QCVQDWRGDDCSSACAPGMWGPQCDMPCSCGNSSSCDPKSGACSCPSGLQPPHCLQPCSP
GRYGPACQFSCQCHGAPCDPHTGACFCPPERTGPSCEVSCHQGTVGFSCPSTHPCHNGGV
FQASQRSCSCPPGWMGTICSLPCREGFHGPNCSQECRCHNGGLCDRFTGQCRCAPGYTGD
RCREECPVGRFGQDCAETCDCAPGARCFPANGACLCEHGFTGDRCAERLCPDGLYGLSCQ
VPCTCDPEHSLSCHPMSGECSCLPGWAGLHCNESCPQDTHGPGCQEHCLCLHGGVCQPDS
GLCRCAPGYTGPHCASLCPPDTYGVNCSVRCSCENAIACSPIDGTCVCKEGWQRGNCSVP
CLPGTWGFGCNASCQCAHEAACSPQTGACTCTPGWHGVHCQLPCPKGQFGEGCASRCDCD
HSDGCDPVHGHCQCQAGWTGARCHLPCPAGFWGVNCSNTCTCKNGGTCIPENGNCVCAPG
FRGPSCQRPCQPGRYGKRCVPCKCANHSSCHPSDGTCYCLAGWTGPDCSQPCPLGHWGAN
CAQPCQCRHGGTCHPQDGSCFCPPGWTGHLCLEGCSPGTFGANCSQACQCGSGERCHPET
GACVCPPGHSGAPCRIGDQETFTIMPTSPVAYNSLGAVIGIAVLGSLVVALVALFIGYRH
WQKGKEHQHLAVAYSSGRLDGSEYVMPDIPPSYSHYYSNPSYHTLSQCSPNPPPPNKVPG
GQLFASLQAPERPGGAHGHDNHATLPADWKHRREPPPGSLDRGGSGPKPSYSCSYSNSNG
PGPFYSKGPISEEGLGASMASLSSENPYATIRDLPSLLGSPRESSYVEMKGPPSGSPPRK
LPQLRNSQRQRHTQPQRDSGTYEQPSPLTHDRDSVGSQPPLPPGLPPGHYDSPKNSHIPG
HYDLPPVRHPPSPPLRRQDR
Download sequence
Identical sequences F6Q970
ENSECAP00000018943 ENSECAP00000018943 9796.ENSECAP00000018943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]