SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6QCN4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6QCN4
Domain Number 1 Region: 72-175
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000251
Family Spermadhesin, CUB domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6QCN4
Sequence length 319
Comment (tr|F6QCN4|F6QCN4_HORSE) Corticotropin releasing hormone binding protein {ECO:0000313|Ensembl:ENSECAP00000015732} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=CRHBP OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MSPSFKLQCHFILIFLMALRGDSRYPELREAAHHDPFLLLSASLKRELAGKPLYRRALRE
LRGIDRRGAIHLHPDRPQLHCAFFIGEPEFITIHYDLVSIDCQGGDFLQVFDGWILKGEK
FPSSQDHPLPTTERYIDFCDSGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFP
CNVISQTPNGRFTLVVPHQHRNCSFSIIYPVAIKISDLTLGHLNGLQLKKPSAGCGGKGD
FVELLGGTGLDPSKMMPLADLCYPFRGPAQMKIGCDNTVVRMVSSGKHINRVTFEYRQLE
PYELENPNGNSIPEFCLSI
Download sequence
Identical sequences F6QCN4
ENSECAP00000015732 ENSECAP00000015732 9796.ENSECAP00000015732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]