SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6QCY0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6QCY0
Domain Number 1 Region: 91-335
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.68e-64
Family G proteins 0.0000000843
Further Details:      
 
Domain Number 2 Region: 413-516
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 6.37e-32
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00016
Further Details:      
 
Domain Number 3 Region: 317-407
Classification Level Classification E-value
Superfamily Translation proteins 9.15e-22
Family Elongation factors 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6QCY0
Sequence length 520
Comment (tr|F6QCY0|F6QCY0_CALJA) G1 to S phase transition 1 {ECO:0000313|Ensembl:ENSCJAP00000033672} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=GSPT1 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
APVESSQEEQSLCEGSNSAVSMELSEPVVENGETEMSPEESWEHKEEISEAEPGSGSLGD
GRPPEESTHEMMEEEEEIPKPKSVVAPPGAPKKEHVNVVFIGHVDAGKSTIGGQIMYLTG
MVDKRTLEKYEREAKEKNRETWYLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDA
PGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQTREHAMLAKTAGVKHLIVLI
NKMDDPTVNWSNERYEECKEKLVPFLKKVGFNPKKDIHFMPCSGLTGANLKEQSDFCPWY
IGLPFIPYLDNLPNFSRSVDGPIRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKH
NVEVLGILSDDVETDTVAPGENLKIRLKGIEEEEILPGFILCDPNNLCHSGRTFDAQIVI
IEHKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRT
AGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLVPEKD
Download sequence
Identical sequences F6QCY0
ENSCJAP00000033672 ENSCJAP00000033672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]